RRM2 antibody orb334549 from Biorbyt

Product Specs
ItemRRM2 antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb334549
Quantity10 µg, 100 µg
ApplicationsIHC, WB
Conjugate/TagUnconjugated
FormatLyophilized
ReactivityHuman, Mouse, Rat
TargetRRM2
IsotypeRabbit IgG
HostRabbit
ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human RRM2 (1-33aa MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT), different from the related mouse and rat sequences by eight amino acids
NCBI Full Gene Nameribonucleotide reductase regulatory subunit M2
NCBI Gene AliasesC2orf48, R2, RR2, RR2M
ClonalityPolyclonal
Molecular Weight44878 MW
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles

Specifications/Features

Application Notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Application Dilutions: Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, By Heat Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat

Add to Compare List